Local

Group Meeting

Mondays at 11:00 am in Bass 424 (unless specified otherwise).

All

Wed, May 4

Raman    
Tue, June 7
Sasha TBA
Don TBA
Alex TBA
Take TBA
John TBA


Protocols

pHLIP Variants

NAME SEQUENCE AUTHOR
D1 DDDEDNPIYWARYAHWLFTTPLLLLHGALLVNADECT FB  
D2 DDDEDNPIYWARYAHWLFTTPLLLLHGALLVDADECT FB  
D3a DDDEDNPIYWARYADWLFTTPLLLLHGALLVDADECT FB  
D3b DDDEDNPIYWARYAHWLFTTPLLLLDGALLVDADECT FB  
D0 DDDEDNPIYWARYAHWLFTTPLLLLHGALLVNANECT FB  
P20G AAEQNPIYWARYADWLFTTGLLLLDLALLVDADEGT FB  
Cys-pHLIP ACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTG MA    
pHLIP-Cys AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG MA  
pHLIP-KC AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTKCG MA  
D25E pHLIP-KC AAEQNPIYWARYADWLFTTPLLLLELALLVDADEGTKCG MA    
R11Q GGEQNPIYWAQYADWLFTTPLLLLDLALLVDADEGTCG JF  
D25Up GGEQNPIYWARYADWLFTTPLLLDLLALLVDADEGTCG JF  
D25Down GGEQNPIYWARYADWLFTTPLLLLLDALLVDADEGTCG JF  
D14Up GGEQNPIYWARYDAWLFTTPLLLLDLALLVDADEGTCG JF  
D14Down GGEQNPIYWARYAWDLFTTPLLLLDLALLVDADEGTCG JF  
R11Q;D14Up GGEQNPIYWAQYDAWLFTTPLLLLDLALLVDADEGTCG JF  
R11Q;D14UpUp GGEQNPIYWAQDYAWLFTTPLLLLDLALLVDADEGTCG JF  
D25A AAEQNPIYWARYADWLFTTPLLLLALALLVDADEGT MM-S  
D25E  AAEQNPIYWARYADWLFTTPLLLLELALLVDADEGT MM-S  
D14A AAEQNPIYWARYAAWLFTTPLLLLDLALLVDADEGT MM-S  
D14E AAEQNPIYWARYAEWLFTTPLLLLDLALLVDADEGT MM-S  
D14/25E AAEQNPIYWARYAEWLFTTPLLLLELALLVDADEGT MM-S  
3D AAEQNPIYWARYADWLFTDLPLLLLDLLALLVDADEGT MM-S  
NNQ GGEQNPIYWARYADWLFTTPLLLLDLALLVNANQGT MZ